Protein Info for Synpcc7942_1266 in Synechococcus elongatus PCC 7942
Name: rdgB
Annotation: Ham1-like protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to IXTPA_NOSS1: dITP/XTP pyrophosphatase (all5088) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to syf:Synpcc7942_1266)Predicted SEED Role
"Xanthosine/inosine triphosphate pyrophosphatase" in subsystem Folate Biosynthesis or Heat shock dnaK gene cluster extended
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (7/9 steps found)
- UTP and CTP dephosphorylation I (5/7 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31NS3 at UniProt or InterPro
Protein Sequence (197 amino acids)
>Synpcc7942_1266 Ham1-like protein (Synechococcus elongatus PCC 7942) MKPLVVATGNPGKLQELQAYLAESGWTLQLKPADLEIEETGQTFAENAALKAQQTAIATG EWAIADDSGLSVDALNGAPGLFSARWGHSDRDRIDRLLRELTGHEQRTAAFICAIAVASP QGNIVLAVEGHCPGEILTAPQGAGGFGYDPIFWVPELQLSFAELAPEQKRQVSHRGRALA QLLPQLRSLATQQTAQP