Protein Info for Synpcc7942_1266 in Synechococcus elongatus PCC 7942

Name: rdgB
Annotation: Ham1-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01725: Ham1p_like
  • amino acids 4 to 184 (181 residues), 212.8 bits, E=2.1e-67
• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 4 to 186 (183 residues), 196.8 bits, E=1.1e-62

Best Hits

Swiss-Prot: 63% identical to IXTPA_NOSS1: dITP/XTP pyrophosphatase (all5088) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to syf:Synpcc7942_1266)

Predicted SEED Role

"Xanthosine/inosine triphosphate pyrophosphatase" in subsystem Folate Biosynthesis or Heat shock dnaK gene cluster extended

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (7/9 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See Q31NS3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Synpcc7942_1266 Ham1-like protein (Synechococcus elongatus PCC 7942)
MKPLVVATGNPGKLQELQAYLAESGWTLQLKPADLEIEETGQTFAENAALKAQQTAIATG
EWAIADDSGLSVDALNGAPGLFSARWGHSDRDRIDRLLRELTGHEQRTAAFICAIAVASP
QGNIVLAVEGHCPGEILTAPQGAGGFGYDPIFWVPELQLSFAELAPEQKRQVSHRGRALA
QLLPQLRSLATQQTAQP