Protein Info for Synpcc7942_1261 in Synechococcus elongatus PCC 7942

Name: tpiA
Annotation: triosephosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 26 to 261 (236 residues), 312 bits, E=1.5e-97
• TIGR00419: triose-phosphate isomerase
  • amino acids 26 to 253 (228 residues), 169.1 bits, E=6.6e-54

Best Hits

Swiss-Prot: 77% identical to TPIS_ANAVT: Triosephosphate isomerase (tpiA) from Anabaena variabilis (strain ATCC 29413 / PCC 7937)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 100% identity to syf:Synpcc7942_1261)

MetaCyc: 49% identical to triosephosphate isomerase subunit (Lactobacillus delbrueckii bulgaricus)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• ethene biosynthesis V (engineered) (24/25 steps found)
• oxygenic photosynthesis (17/17 steps found)
• Calvin-Benson-Bassham cycle (13/13 steps found)
• gluconeogenesis I (12/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• gluconeogenesis III (8/12 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• glycerol degradation to butanol (8/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

See Q31NS8 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Synpcc7942_1261 triosephosphate isomerase (Synechococcus elongatus PCC 7942)
LGEVRRHLKLVNGLARSEQSAVRRIIIAGNWKMYKTQAEALEFLQAFLPQLSETPESRKV
VLCAPFTTLSSLSKTLHGSRVRVGAQNIHWAKEGAFTGEISGAMLTEIGVRYVVVGHSER
RQYFGETDETVNQRLLAAQSFGLLPILCVGESKQQRDAGETEAVISRQLERGLVGADQTN
LVIAYEPIWAIGTGDTCAAEEANRVIGLIRSQLKDTDVPIQYGGSVKPENIDEIMAQPEI
DGALVGGASLEAESFARIVNYQS