Protein Info for Synpcc7942_1256 in Synechococcus elongatus PCC 7942

Name: gst
Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF02798: GST_N" amino acids 2 to 74 (73 residues), 69.5 bits, see alignment E=7.5e-23 PF13417: GST_N_3" amino acids 12 to 78 (67 residues), 51.2 bits, see alignment E=3.8e-17 PF13409: GST_N_2" amino acids 15 to 74 (60 residues), 56.7 bits, see alignment E=9.1e-19 PF14497: GST_C_3" amino acids 108 to 176 (69 residues), 29.7 bits, see alignment E=1.9e-10 PF00043: GST_C" amino acids 111 to 175 (65 residues), 31.8 bits, see alignment E=4.3e-11

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to syc:syc0295_c)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NT3 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Synpcc7942_1256 glutathione S-transferase (Synechococcus elongatus PCC 7942)
MLKLYGSARTRASLVAWYLEELGQPYESVAVDMAAGEHRQPTFLSLNPFGKVPALVDDAF
TLWESGAILLYLAEKFGELQTPQDRAIAAQWVLFANATLGPGLFVEANRAKEAPRLLGSL
NTLLSQREYLVSDRLSVSDVAVGSYLAYVPMFFPDFDLSPYPAVQDYIRRLTQRPAYQQS
IGRR