Protein Info for Synpcc7942_1237 in Synechococcus elongatus PCC 7942

Name: nrtC
Annotation: nitrate transport ATP-binding subunits C and D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 25 to 254 (230 residues), 433.9 bits, see alignment E=6.9e-135 PF00005: ABC_tran" amino acids 25 to 166 (142 residues), 114.7 bits, see alignment E=5.2e-37 PF13379: NMT1_2" amino acids 275 to 523 (249 residues), 194.7 bits, see alignment E=2.5e-61

Best Hits

Swiss-Prot: 100% identical to NRTC_SYNE7: Nitrate import ATP-binding protein NrtC (nrtC) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to syf:Synpcc7942_1237)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein / Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P38045 at UniProt or InterPro

Protein Sequence (659 amino acids)

>Synpcc7942_1237 nitrate transport ATP-binding subunits C and D (Synechococcus elongatus PCC 7942)
MSVFLAVDHVHQVFDLPGGGQYIALKDVSLNIRPGEFISLIGHSGCGKSTLLNLIAGLAQ
PSSGGIILEGRQVTEPGPDRMVVFQNYSLLPWRTVRQNIALAVDSVLHDRNRTERRTIIE
ETIDLVGLRAAADKYPHEISGGMKQRVAIARGLAIRPKLLLLDEPFGALDALTRGNLQEQ
LMRICQEAGVTAVMVTHDVDEALLLSDRVVMLTNGPAAQIGQILEVDFPRPRQRLEMMET
PHYYDLRNELINFLQQQRRAKRRAKAAAPAPAVAASQQKTVRLGFLPGNDCAPLAIAQEL
GLFQDLGLSVELQSFLTWEALEDSIRLGQLEGALMMAAQPLAMTMGLGGHRPFAIATPLT
VSRNGGAIALSRRYLNAGVRSLEDLCQFLAATPQRLRLAIPDPIAMPALLLRYWLASAGL
NPEQDVELVGMSPYEMVEALKAGDIDGFAAGEMRIALAVQAGAAYVLATDLDIWAGHPEK
VLGLPEAWLQVNPETAIALCSALLKAGELCDDPRQRDRIVEVLQQPQYLGSAAGTVLQRY
FDFGLGDEPTQILRFNQFHVDQANYPNPLEGTWLLTQLCRWGLTPLPKNRQELLDRVYRR
DIYEAAIAAVGFPLITPSQRGFELFDAVPFDPDSPLRYLEQFEIKAPIQVAPIPLATSA