Protein Info for Synpcc7942_1201 in Synechococcus elongatus PCC 7942

Annotation: probable glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF13489: Methyltransf_23" amino acids 29 to 141 (113 residues), 34.6 bits, see alignment E=6.4e-12 PF07021: MetW" amino acids 35 to 153 (119 residues), 22.5 bits, see alignment E=3.3e-08 PF13847: Methyltransf_31" amino acids 44 to 145 (102 residues), 30.3 bits, see alignment E=1.4e-10 PF13649: Methyltransf_25" amino acids 47 to 135 (89 residues), 32.5 bits, see alignment E=4.6e-11 PF08242: Methyltransf_12" amino acids 48 to 138 (91 residues), 50 bits, see alignment E=1.7e-16 PF08241: Methyltransf_11" amino acids 48 to 140 (93 residues), 27 bits, see alignment E=2.2e-09 PF13641: Glyco_tranf_2_3" amino acids 237 to 361 (125 residues), 32.1 bits, see alignment E=4.5e-11 PF00535: Glycos_transf_2" amino acids 240 to 367 (128 residues), 71.8 bits, see alignment E=2.8e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0349_d)

Predicted SEED Role

"Glycosyl transferase, family 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8KPR8 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Synpcc7942_1201 probable glycosyltransferase (Synechococcus elongatus PCC 7942)
MNDHTAAIAAHFDQLAPNLDRWRRRNRTYYRDLEKLHRFWIPTGSRVLQVGSGLGDLLAT
VEPSFGIGIDVSPQAVAIAQQRHPQLQFHCLAAEELTPEAIGNPEPFDAIILTGVLSYLT
DIQVVLEQLQAFCHPRTRLILGFHNFLWQPLLTAAEKVGQRSPQPPESWLGMQDVLNLLT
LTGYEPIKQGRRFLLPRQIPLLTGWINRWISPLPVIEHLALTNYVIARPLAQPRSQPTVS
VIVPARNEAGNIAAAVERLPELGAETELIFVEGHSRDQTWETIEQTVAEYQGPLKLLACR
QTGKGKADAVRLGFDKASGDILMILDADLTVQPEDLGHFYRAIASGRGEFINGSRLVYPR
SRLAMPGLNTLANRTFALIFSFLLGQPLKDTLCGTKVLWKTDYDRVAAGRKYFGDFDPFG
DFDLLFGAAKLGLKIVEVPVRYQERSYGSSNIAHVREGLILARMCLYAAGKLKFPH