Protein Info for Synpcc7942_1197 in Synechococcus elongatus PCC 7942

Name: trpC
Annotation: indole-3-glycerol-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00218: IGPS
  • amino acids 32 to 288 (257 residues), 288.9 bits, E=1.4e-90

Best Hits

Swiss-Prot: 100% identical to TRPC_SYNP6: Indole-3-glycerol phosphate synthase (trpC) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01609, indole-3-glycerol phosphate synthase [EC: 4.1.1.48] (inferred from 100% identity to syc:syc0353_d)

Predicted SEED Role

"Indole-3-glycerol phosphate synthase (EC 4.1.1.48)" in subsystem Tryptophan synthesis (EC 4.1.1.48)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.48

Sequence Analysis Tools

See Q8KPR4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Synpcc7942_1197 indole-3-glycerol-phosphate synthase (Synechococcus elongatus PCC 7942)
MEVRRRPPNPAVHVASLTYQVKVPGSSPSNILEEIVWYKEREVNAWREQLPLQQLQNQVR
GLTQTPRDFLAALRQAPTRPAVIAEVKKASPSKGVLREDFDPVAIAQAYAANGAACISVL
TDEKFFQGGFENLQRVRAAVDVPLLCKDFVIYPYQIYKARLLGADAVLLIAAILSDADLR
YFLKIAHSLGLNALVEVHSLPELERVLALDDLRLVGINNRNLKTFVTDLAVTEHLAAQCR
DRDLLLVSESGLFTGADLDRVTQAGAQAVLIGESLVKQPDPGLALQQLVGDRPSA