Protein Info for Synpcc7942_1173 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR04282: transferase 1, rSAM/selenodomain-associated" amino acids 5 to 195 (191 residues), 221.4 bits, see alignment E=8.4e-70 PF01983: CofC" amino acids 18 to 185 (168 residues), 27.6 bits, see alignment E=3.2e-10 PF09837: DUF2064" amino acids 46 to 162 (117 residues), 124.2 bits, see alignment E=5.3e-40 PF13641: Glyco_tranf_2_3" amino acids 202 to 386 (185 residues), 40.5 bits, see alignment E=5.9e-14 TIGR04283: transferase 2, rSAM/selenodomain-associated" amino acids 204 to 421 (218 residues), 265.6 bits, see alignment E=3.4e-83 PF00535: Glycos_transf_2" amino acids 205 to 330 (126 residues), 74.8 bits, see alignment E=1.6e-24

Best Hits

KEGG orthology group: K09931, hypothetical protein (inferred from 100% identity to syc:syc0377_c)

Predicted SEED Role

"All5102 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31P16 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Synpcc7942_1173 hypothetical protein (Synechococcus elongatus PCC 7942)
MSQRLILFSRYPEPGRSKTRLIPALGPEGAADLQRQLTEWTVFTAHCWQARSPQTEVLIA
TSGGTSEAWQQWLGAVEVQPQAEGDLGDRLHQAFQDSWQVGCDRTVIIGSDCPQIEPHHL
DEAFAALQQADVVIGPASDGGYWLIGLSQPQPQLFQNIDWGSDRVLVQTLEAAQVADLQV
AQLESLSDLDRPEDLNLWQPQPQLSVIITTLNEAANLPQTLASIGDAPVETLVVDGGSQD
ATVAIAQAWGAKVIHSPAGRGRQFNQGAAAAHGNILLFLHGDTRLPPRFWEHVLQTLQPP
QVVAGAFQLQIDSPDWRLRWIERGVRWRSHWLQQPYGDQALFLSRDRWRAIGGFSTGPLL
EDYRFVRQLRRQGTIAIASAAVMTSARRWQRRGVLQTTLLNQLILLAHHCGVSDQQLARW
YR