Protein Info for Synpcc7942_1146 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 PF01722: BolA" amino acids 30 to 80 (51 residues), 64.3 bits, see alignment E=5.1e-22

Best Hits

Swiss-Prot: 63% identical to Y3122_SYNY3: Uncharacterized protein ssr3122 (ssr3122) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 99% identity to syf:Synpcc7942_1146)

Predicted SEED Role

"YrbA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31P43 at UniProt or InterPro

Protein Sequence (88 amino acids)

>Synpcc7942_1146 hypothetical protein (Synechococcus elongatus PCC 7942)
LQPMVTPEQVESMICAQIPDAQVMVNDLTGGGDHLQVTVVSSAFAGKSLIKQHQLVYGAV
QAAMSTEAIHALALKTYTPDRWLNEAQG