Protein Info for Synpcc7942_1142 in Synechococcus elongatus PCC 7942

Name: metS
Annotation: methionyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF00133: tRNA-synt_1" amino acids 4 to 217 (214 residues), 39.1 bits, see alignment E=8.4e-14 amino acids 222 to 332 (111 residues), 38.9 bits, see alignment E=9.5e-14 PF09334: tRNA-synt_1g" amino acids 7 to 147 (141 residues), 144.7 bits, see alignment E=7.2e-46 amino acids 140 to 365 (226 residues), 216.7 bits, see alignment E=9.3e-68 TIGR00398: methionine--tRNA ligase" amino acids 7 to 485 (479 residues), 539.1 bits, see alignment E=6.3e-166 PF19303: Anticodon_3" amino acids 376 to 493 (118 residues), 39.4 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 72% identical to SYM_NOSS1: Methionine--tRNA ligase (metG) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 100% identity to syf:Synpcc7942_1142)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31P47 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Synpcc7942_1142 methionyl-tRNA synthetase (Synechococcus elongatus PCC 7942)
MPSTFALTTPLYYVNDVPHIGSAYTTIAADAIARFHRLQGDRVLMITGSDEHGQKIQRTA
EKNGKPPQEHCNAIVARFQDLWQLLNIRYDRFSRTTDPRHQAIVEVFYRRVEAQGDIYVG
RQQGWYCVACEEFKEERDLLEDKRCPIHTNQAVEWRDEENYFFRLSRYQEALEAHYAANP
DFIQPESRRNEVLSFVERGLQDFSISRVNLEWGFAVPDNPKHTLYVWFDALLGYVTALLD
PDAEPTLENALSQWWPINLHLIGKDILRFHAVYWPAMLLSAGLPLPDRVFGHGFLTKDGL
KMGKSLGNTLDPFDLVDRFGSDAVRYYFLKEIEFGRDGDYQETRFVNVVNADLANDLGNL
LNRTLSMAKRYCQLQIPLGSTAIAADNPLRQQGEALTDSVKSAYDRLAFSEACGQILALV
QAGNRYLDQEAPWTRFKQGEQAKVEEILYTVLESVRLAAYWLSPLVPGISQEIYRQLGLV
ADFNDPAIAQQLDPESHGHWGFLPAAQQFLDPSPVFRSLELAPAD