Protein Info for Synpcc7942_1118 in Synechococcus elongatus PCC 7942

Annotation: mercuric reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 38 to 357 (320 residues), 207.5 bits, see alignment E=9.1e-65 PF01134: GIDA" amino acids 39 to 111 (73 residues), 19.9 bits, see alignment E=1.1e-07 PF13738: Pyr_redox_3" amino acids 159 to 343 (185 residues), 34.6 bits, see alignment E=3.9e-12 PF00070: Pyr_redox" amino acids 208 to 284 (77 residues), 75.8 bits, see alignment E=9.6e-25 PF02852: Pyr_redox_dim" amino acids 383 to 492 (110 residues), 101.6 bits, see alignment E=8.7e-33

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 100% identity to syf:Synpcc7942_1118)

Predicted SEED Role

"Mercuric ion reductase (EC 1.16.1.1)" in subsystem Mercuric reductase or Mercury resistance operon (EC 1.16.1.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31P71 at UniProt or InterPro

Protein Sequence (516 amino acids)

>Synpcc7942_1118 mercuric reductase (Synechococcus elongatus PCC 7942)
LSSQSFIAFVSPADSHNQLLIDRVHPQDWINPEPADCYDLVVIGAGTTGLVVAAGATGLG
LGLKVALIEKQLMGGDCLNFGCVPSKALIRSSRVIGELQRANTLGIQVAPEAIAVDFAAV
MERLRKVRAGMSVHDSAQRFQALGVDVFLGQACFCDRNTIQVGEATLKFRKAVIATGARA
TYPNIEGLEASGFLTNETVFSLSNCPRRLAVIGGGPIGCELAQAFQRLGSQVTLFQRRSQ
LLPKEDFEAAEVIQNQLRADGVQVCLSAEITRIERTASGKLITFRQEGRESVLEVDEILV
GTGRSPNVQDLNLEAVGVDYDSVHGVKVNDYLQTTNPKIYAAGDVCSPWKFTHAADAAAR
IVIKNALFSPFGLGKSKVSDLIIPRVTFTDPEVAHVGLSETAARHQGIAIATITIPLDQV
DRTVLDGETAGFIRIHHQPNSDKILGATIVAPHAGEMISEVTTAIANQLGMSALSSVIHP
YPTQAEGIKKAADNYRRTLLTPMTKQLLKLLMIFSK