Protein Info for Synpcc7942_1055 in Synechococcus elongatus PCC 7942

Name: cpcF
Annotation: phycocyanin alpha-subunit phycocyanobilin lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13646: HEAT_2
  • amino acids 66 to 163 (98 residues), 44.7 bits, E=2e-15
• PF03130: HEAT_PBS
  • amino acids 79 to 102 (24 residues), 18.1 bits, see alignment (E = 4.6e-07)
• PF02985: HEAT
  • amino acids 145 to 167 (23 residues), 17.9 bits, see alignment (E = 4.3e-07)

Best Hits

Swiss-Prot: 100% identical to CPCF_SYNE7: Phycobilisome maturation protein (cpcF) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02289, phycocyanobilin lyase beta subunit (inferred from 100% identity to syc:syc0493_c)

MetaCyc: 100% identical to phycocyanin alpha-subunit phycocyanobilin lyase subunit alpha (Synechococcus elongatus PCC 7942 = FACHB-805)
RXN-15984 [EC: 4.4.1.32]

Predicted SEED Role

"Phycocyanobilin lyase beta subunit" in subsystem Bilin Biosynthesis or Phycobilisome

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.32

Sequence Analysis Tools

See Q44116 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Synpcc7942_1055 phycocyanin alpha-subunit phycocyanobilin lyase (Synechococcus elongatus PCC 7942)
MSTELIAAVEAADSAEGLVRAVAALSAARTDAAIPTLISVLAFNNPGAAVVAVDGLIQLG
SPAAQAILNNLDDYNYGARAWALRALAGIGEPAALPLLLSAAREDFSLSVRRAATYGLGR
VRWADLSESDRLAQQQQCYETLKLCLQYDPEWVVRYAAAAALETLAPAATQLQSAIAETL
NRQAHSDEERAVQARSRLAERRLAAGV