Protein Info for Synpcc7942_1024 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details PF00892: EamA" amino acids 24 to 152 (129 residues), 84.6 bits, see alignment E=3.9e-28 amino acids 165 to 298 (134 residues), 76.6 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0522_d)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PG5 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Synpcc7942_1024 hypothetical protein (Synechococcus elongatus PCC 7942)
MGDDQSDRLRCAGLPLKFPVSLQLAIATALWGGTFTAGRIAVQQLSPLAVACGRYLLATT
VLLLILWQREGWPPLNRRQQLLLFGLGVSGIALYNWLFFIGLSLIPASRAALIIALNPTA
IALGAAIWTGDRLRSWQWAGVGLSLIGAILLLGSRQAGALTLPGWGDLALVGCVLCWTVY
SLLARQALRSLSPLTVTTGACCWGSVLLIGLWLGQGAQLPVNVSFSTGSAIAFLGLGGTA
LAFCLYANGIERLGAARAGLFINLVPVFGSAIGALLLQEPLSGLTLLGGLLVLAGVGLGT
LQRLQPVPISTTEPVGGDRSPGPPALGHDR