Protein Info for Synpcc7942_1007 in Synechococcus elongatus PCC 7942

Name: fumC
Annotation: fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00979: fumarate hydratase, class II
  • amino acids 8 to 463 (456 residues), 732.3 bits, E=1.1e-224
• PF00206: Lyase_1
  • amino acids 15 to 345 (331 residues), 361.1 bits, E=5.7e-112
• PF10415: FumaraseC_C
  • amino acids 411 to 463 (53 residues), 77 bits, 1.2e-25

Best Hits

Swiss-Prot: 64% identical to FUMC_THEEB: Fumarate hydratase class II (fumC) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 100% identity to syc:syc0538_d)

MetaCyc: 58% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle III (animals) (7/10 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• TCA cycle VI (Helicobacter) (5/9 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (5/14 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (3/13 steps found)
• methylaspartate cycle (7/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

See Q31PI2 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Synpcc7942_1007 fumarate hydratase (Synechococcus elongatus PCC 7942)
MTETANQRRESDSMGEVLVPTDRYWGAQTQRSLHYFSIGQDRMPIEVCHALAIAKKASAL
ANRDLGVLSAEKADLIAQAADEIIAGQLDDHFPLYVWMTGSGTQANMNVNEVIANRAIEM
AGGVLGSKTPIHPNDDVNRSQSSNDVFPTAMHIAAAQAIGRQLLPSIERLEQSLQAKVDE
WQGIVKIGRTHLQDAVPLTLGQEFSGFVAMLAENRQRLHNALQELYPLALGGTAVGTGLN
APTGFDVAVADYIAQLTGLPFVTATNKFAQIGAHDAFVALSGSLRGLAVSLYKIANDIRL
LACGPRCGFNELSLPANEPGSSIMPGKVNPTQCEALAMVAVQVMGYDAAVAFAGASGYLE
LNVYKPLMVYNVLESIRILSDASDNFRRFTVEGMTANTDQINTYLERSLMLVTALTPAIG
YDQAAKVAKYAFEKNLSLKEACLELGCISSEEFDRWVDPAQLV