Protein Info for Synpcc7942_1005 in Synechococcus elongatus PCC 7942

Annotation: HAD-superfamily hydrolase subfamily IA, variant 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00702: Hydrolase" amino acids 7 to 192 (186 residues), 48.8 bits, see alignment E=1.8e-16 PF13419: HAD_2" amino acids 134 to 198 (65 residues), 36.1 bits, see alignment E=1.1e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 140 to 198 (59 residues), 46.7 bits, see alignment E=1.9e-16 PF13242: Hydrolase_like" amino acids 154 to 202 (49 residues), 26.1 bits, see alignment E=9.9e-10

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to syf:Synpcc7942_1005)

Predicted SEED Role

"Haloacid dehalogenase-like hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PI4 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Synpcc7942_1005 HAD-superfamily hydrolase subfamily IA, variant 3 (Synechococcus elongatus PCC 7942)
MLQLLDYDAIIFDFGGVILDLDYQSTRRAFEELCGCDWHALYSQQQQTALFDDFETGRID
PATFRDSLRQLLGQDLSDRAIDTAWNAMLGGVPLVHVEFLEQLRSQRPIFLLSNTNAIHQ
EAFEQRFIDDHGDRHSSLPALFEQAYYSHHLGDRKPHASIFQTVIDRHQLDPSRTLFLDD
SPQHLEGAKQAGLHTAWIPSGQLLEQVQL