Protein Info for Synpcc7942_0986 in Synechococcus elongatus PCC 7942

Annotation: probable glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF13579: Glyco_trans_4_4" amino acids 16 to 177 (162 residues), 70 bits, see alignment E=9.4e-23 PF13439: Glyco_transf_4" amino acids 16 to 182 (167 residues), 86.2 bits, see alignment E=8.1e-28 PF00534: Glycos_transf_1" amino acids 197 to 349 (153 residues), 81.5 bits, see alignment E=1.6e-26 PF13692: Glyco_trans_1_4" amino acids 199 to 330 (132 residues), 78.4 bits, see alignment E=2.1e-25 PF20706: GT4-conflict" amino acids 239 to 301 (63 residues), 27.8 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0558_c)

MetaCyc: 67% identical to digalactosyldiacylglycerol synthase (Synechocystis sp. PCC 6803)
Digalactosyldiacylglycerol synthase. [EC: 2.4.1.241]

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PK3 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Synpcc7942_0986 probable glycosyltransferase (Synechococcus elongatus PCC 7942)
MRIAWLGKKSPFCGNVTYSREITNALRDRGHDVSFFHFAQSEAEASDEGSEGIEVSLPCL
YKSQIYTIPSFRSSKVLKSSLEEIRPDLVHASLTLSPLDFLLPEICEELGLPLVATFHPA
FDHKLRNISSGTQHLTYQLYAPCLARYDRTVVFSQIQRDLLIRLGVPSDRIAVIPNGVDI
DRYSPGPSDFKQQLGVDRLFVYMGRIAAEKNVEALLRGWKLANLGPESRLLIVGDGTLRS
LLEVSYGPEQGVQWWGFEADEQRRIQMLRAADAFILPSFVEGLSLSLLEAMACGVACLAT
DAGADGEVLEGGAGIVLNPQRTSAQLQTLLPVLRDQPELSAILGCKARQRVLDRYTLEGN
LDRLEQLYQDLLPAAVLSASAVS