Protein Info for Synpcc7942_0969 in Synechococcus elongatus PCC 7942
Annotation: Carboxymethylenebutenolidase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to DLHH_METEA: Putative carboxymethylenebutenolidase (MexAM1_META1p1735) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 100% identity to syc:syc0574_d)Predicted SEED Role
"Dienelactone hydrolase family"
MetaCyc Pathways
- 4-chlorocatechol degradation (2/5 steps found)
- 4,5-dichlorocatechol degradation (3/7 steps found)
- 3,4,6-trichlorocatechol degradation (4/9 steps found)
- 3-chlorocatechol degradation I (ortho) (1/5 steps found)
- 3-chlorocatechol degradation II (ortho) (1/5 steps found)
- 3,5-dichlorocatechol degradation (3/8 steps found)
- 1,4-dichlorobenzene degradation (3/9 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.45
Use Curated BLAST to search for 3.1.1.45
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31PM0 at UniProt or InterPro
Protein Sequence (275 amino acids)
>Synpcc7942_0969 Carboxymethylenebutenolidase (Synechococcus elongatus PCC 7942) MNNLTRRQFLATATLATGFALAARPISAAVIKTDSKGLETGTAQIPTADGLLPAYWARPT SGQVFPIVLVVQEIFGVHEHIQDVCRRFAKLGYLAIAPELFVRQGDVSKLESIDEIRKIV SKVPDAQVMADLDATVAWASTQKGDRDRLAITGFCWGGRITWLYAAHNPQVKTGAAWYGR LVGNSTELTPKHPVDVAAELKVPVLGLYGGEDTGIPLGTVQQMRDRLKTGSSKSAIIVYE GAPHAFFADYRPSYRQGDAQDAWQRLQTWFKQHGV