Protein Info for Synpcc7942_0949 in Synechococcus elongatus PCC 7942

Annotation: permease protein of sugar ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 67 to 89 (23 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 271 (193 residues), 70.4 bits, see alignment E=8.7e-24

Best Hits

Swiss-Prot: 44% identical to MALF_THELN: Trehalose/maltose transport system permease protein MalF (malF) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to syf:Synpcc7942_0949)

MetaCyc: 40% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PP0 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Synpcc7942_0949 permease protein of sugar ABC transporter (Synechococcus elongatus PCC 7942)
MTHPPRWLTIPALLTITGVFAYPLLRAAWLSLQALNLNTQLQPVFIGLANYQRLWGDSRF
WGDLFNTTVFTVTSVSLELVLGLAIALLLHQPSRWRGPLRTIALLPWVLPTAVMALGWAW
IFNDPYGVWNDWLQQLGWIAAPINWLGNPRWAWLTLVAADVWKTTPFVAILLLAGRQAIP
EDLYEAHCLEGATAWQSFWQITLPLLRPQLAIALLFRSAQAFGLFDLVKVMTGGGPANST
ETLALYAYTTALRYLDFGYGATLAIVTAAILAAGLGLIWGLGRSRSTPSGGL