Protein Info for Synpcc7942_0946 in Synechococcus elongatus PCC 7942

Name: aoxA
Annotation: UDP-galactopyranose mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00070: Pyr_redox
  • amino acids 42 to 76 (35 residues), 22.2 bits, 6e-08
• PF00890: FAD_binding_2
  • amino acids 43 to 77 (35 residues), 27.4 bits, 7e-10
• PF12831: FAD_oxidored
  • amino acids 43 to 79 (37 residues), 27.3 bits, 8e-10
• PF01266: DAO
  • amino acids 43 to 76 (34 residues), 30.2 bits, see alignment (E = 1.2e-10)
• PF13450: NAD_binding_8
  • amino acids 45 to 109 (65 residues), 40.6 bits, E=8.6e-14
• PF01593: Amino_oxidase
  • amino acids 50 to 476 (427 residues), 258.2 bits, E=6.9e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0596_c)

Predicted SEED Role

"Amine oxidase, flavin-containing (EC 1.4.3.4)" (EC 1.4.3.4)

MetaCyc Pathways

• phenylethylamine degradation I (2/2 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• superpathway of phenylethylamine degradation (2/11 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.4

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See Q31PP3 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Synpcc7942_0946 UDP-galactopyranose mutase (Synechococcus elongatus PCC 7942)
MRFSRRRFLQSSLGAAATTGLAGTLAAGGQAQTRSTPVRKRSVLVLGAGMAGLTAALSLL
RRGHQVTVIEYQNRIGGRLLSVPLKGGQFSEAGGGHFRANMPYVLSYIRHFKLPLLTLND
GLPRYLFDGKTADAADLSRWPWDLAPQERRVSVASLLNTYLILNGLDTDTVLDANWPDAQ
AIQQLDNLTLSQLIRQVGGSEAFIQLLDAHGGTFTSSSPALGVIPDLAYHFGDQNLFRIQ
GGNDRLPKAMAAAIGSERFILDAPVVAIDQQANRATVTVKDGRTFQGDAIISTIPFTVLP
EVAVRPGWSAGKRRMFAEMEWEQTVKVIAQTRSPVWLAQNVHGWPMAGSDRPWERVIDIT
GNEGGGYGNTFFYLNGRNKDAMLARPKSERAQAIVDQFRSDLPDLFDEVVTLADFAWGEQ
PWIRGSFGGPPLGGAWMIREWTTPEGLIHFAGDFTTMKSGWVEGAIESGLRAARQIDPGA
QPEADTFLRQEQRCN