Protein Info for Synpcc7942_0896 in Synechococcus elongatus PCC 7942

Name: minD
Annotation: septum site-determining protein MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF10609: ParA" amino acids 2 to 238 (237 residues), 77.3 bits, see alignment E=4.6e-25 PF09140: MipZ" amino acids 3 to 145 (143 residues), 37.2 bits, see alignment E=7.4e-13 PF13614: AAA_31" amino acids 3 to 154 (152 residues), 70.6 bits, see alignment E=5.9e-23 TIGR01968: septum site-determining protein MinD" amino acids 3 to 262 (260 residues), 396.1 bits, see alignment E=3.2e-123 PF06564: CBP_BcsQ" amino acids 4 to 235 (232 residues), 47.7 bits, see alignment E=5.3e-16 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 32.4 bits, see alignment 2e-11 PF01656: CbiA" amino acids 5 to 218 (214 residues), 80.6 bits, see alignment E=3.4e-26

Best Hits

Swiss-Prot: 70% identical to MIND_GUITH: Putative septum site-determining protein MinD (minD) from Guillardia theta

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 100% identity to syf:Synpcc7942_0896)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PU3 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Synpcc7942_0896 septum site-determining protein MinD (Synechococcus elongatus PCC 7942)
MSRVIVVTSGKGGVGKTTSSANLGMALAQLGKRLVLIDADFGLRNLDLLLGLENRIVYTA
QDVLAGNCRLEQALVKDKRQPNLCLLPAANNRMKESVTPQQMEQLVTLLDGQFDVILIDS
PAGIEAGFQNAIAAAREAVIVTTPEIAAVRDADRVIGLLEAHGITEIRLILNRLRPAMVK
ANDMMSVEDVQEILAIPLVGIIPDDEQVIISTNRGEPLVLAEAPSLAAKAFINVARRLSG
ESIDFLNLEEPQSGVLSKIRRILNKKIL