Protein Info for Synpcc7942_0839 in Synechococcus elongatus PCC 7942

Name: merR
Annotation: Nitrilase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04048: putative nitrilase, sll0784 family
  • amino acids 5 to 302 (298 residues), 542.7 bits, E=9.4e-168
• PF00795: CN_hydrolase
  • amino acids 7 to 277 (271 residues), 187.7 bits, E=1.3e-59

Best Hits

Swiss-Prot: 49% identical to NITR3_UNKP: Nitrilase 3 (BD5308) from Unknown prokaryotic organism

KEGG orthology group: K01501, nitrilase [EC: 3.5.5.1] (inferred from 100% identity to syf:Synpcc7942_0839)

Predicted SEED Role

"Nitrilase (EC 3.5.5.7)" (EC 3.5.5.7)

MetaCyc Pathways

• acrylonitrile degradation II (1/1 steps found)
• indole-3-acetate biosynthesis V (bacteria and fungi) (1/1 steps found)
• superpathway of acrylonitrile degradation (2/3 steps found)
• indole glucosinolate activation (herbivore attack) (8/13 steps found)
• indole-3-acetate biosynthesis II (4/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Nitrogen metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.5.1 or 3.5.5.7

Sequence Analysis Tools

See Q31PZ9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Synpcc7942_0839 Nitrilase (Synechococcus elongatus PCC 7942)
MADKIIVAAAQIRPVLFSLEGSVARVLAAMAEAAAAGVQLIVFPETFLPYYPYFSFVEPP
VLMGRSHLKLYEQAFTMTGPELQQIARAARQHRLFVLLGVNERDGGSLYNTQLLISDQGD
LLLKRRKITPTYHERMVWGQGGGAGLTVVETVLGKVGALACWEHYNPLARFSLMTQGEEI
HCAQFPGSLVGPIFSEQTAVTLRHHALEAGCFVLSSTAWLDPADYDTITPDRSLHKAFQG
GCHTAIISPEGRYLAGPLPEGEGLAIAELDKSLITKRKRMMDSVGHYSRPDLLSLRINRS
PATQVQAIGSAAALPELPNLEAAPAETAEDYLHA