Protein Info for Synpcc7942_0835 in Synechococcus elongatus PCC 7942

Name: ruvB
Annotation: Holliday junction DNA helicase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF05496: RuvB_N" amino acids 48 to 206 (159 residues), 249.3 bits, see alignment E=4.1e-78 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 52 to 354 (303 residues), 456.1 bits, see alignment E=2.4e-141 PF07728: AAA_5" amino acids 82 to 200 (119 residues), 36.6 bits, see alignment E=1.3e-12 PF00004: AAA" amino acids 83 to 204 (122 residues), 65.9 bits, see alignment E=1.6e-21 PF17864: AAA_lid_4" amino acids 209 to 282 (74 residues), 105.4 bits, see alignment E=3.2e-34 PF05491: RuvB_C" amino acids 285 to 353 (69 residues), 81.9 bits, see alignment E=7.7e-27

Best Hits

Swiss-Prot: 100% identical to RUVB_SYNE7: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 100% identity to syf:Synpcc7942_0835)

MetaCyc: 59% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q03 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Synpcc7942_0835 Holliday junction DNA helicase B (Synechococcus elongatus PCC 7942)
MAIVSSKSPDPAERRSQAKTKPSVSEPQDSLVRPQAAPEESQRPEDQIRPQRLADYIGQP
ELKDVLGIAIAAAKSRQESLDHLLLYGPPGLGKTTMALVLATEMGVQCRITTAPALERPR
DIVGLLVNLQPGDVLFIDEIHRLPKVTEEILYPAMEDFRLDITIGKGQSARTRSITLQPF
TLVGATTQIGALTSPLRDRFGLVQRLRFYEVEALTDIVQRTARLLNTPLDQAGAEEIAKR
SRGTPRIANRLLRRVRDYAAVKAPGPITGAIAATALELYNVDPCGLDWTDRRLLSHLIEN
FGGGPVGLETLAAATGEDAQTVEEVYEPYLLQIGYLQRTPRGRVATPAAWRHLGYEPPQA
SGQLTLQQLLTEPET