Protein Info for Synpcc7942_0822 in Synechococcus elongatus PCC 7942

Name: appB
Annotation: permease protein of oligopeptide ABC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 9 to 82 (74 residues), 34.8 bits, see alignment E=1.6e-12 PF00528: BPD_transp_1" amino acids 120 to 340 (221 residues), 128.9 bits, see alignment E=2e-41

Best Hits

Swiss-Prot: 38% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to syf:Synpcc7942_0822)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q15 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Synpcc7942_0822 permease protein of oligopeptide ABC (Synechococcus elongatus PCC 7942)
MSRARDLGRYLLARLLLLPLMLWTIATLIFLLLRATPGDPIDAILGPKAPAAARLALRSQ
LGLDRPLWQQYFDYLGQLLKGDLGQSLSSQGQSVRQIIGEYFPATAELAIASLAIAIAIG
LGLGLMAAAKPNSRRETASRLFGILTYALPTFWAAMLAQLLFAVDLGWFPVGTRYPVTLD
PPLGPTGLYVLDALLKADWRAAGLALRYLALPALTLGLLLSGVFERLVRVNLGQSLQADY
IDAGRSRGLSERRLLLNHALRNALIPVVTLLGLTLASLLGGALLTEVAFSWPGLANRLYE
AISLRDYSTVQGIIVFFGCLVVLASIVVDFINALIDPRIRY