Protein Info for Synpcc7942_0801 in Synechococcus elongatus PCC 7942

Name: sodB
Annotation: Superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00081: Sod_Fe_N" amino acids 30 to 114 (85 residues), 102.1 bits, see alignment E=2e-33 PF02777: Sod_Fe_C" amino acids 122 to 222 (101 residues), 136.5 bits, see alignment E=3.1e-44

Best Hits

Swiss-Prot: 100% identical to SODF_SYNE7: Superoxide dismutase [Fe] (sodB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to syf:Synpcc7942_0801)

MetaCyc: 54% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18655 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Synpcc7942_0801 Superoxide dismutase (Synechococcus elongatus PCC 7942)
VLQETLRRGKRPVFINLGKDNLLKRTHCMSYELPALPFDYTALAPYITKETLEFHHDKHH
AAYVNNYNNAVKDTDLDGQPIEAVIKAIAGDASKAGLFNNAAQAWNHSFYWNSIKPNGGG
APTGALADKIAADFGSFENFVTEFKQAAATQFGSGWAWLVLDNGTLKITKTGNADTPIAH
GQTPLLTIDVWEHAYYLDYQNRRPDYISTFVEKLANWDFASANYAAAIA