Protein Info for Synpcc7942_0774 in Synechococcus elongatus PCC 7942

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF12146: Hydrolase_4" amino acids 22 to 242 (221 residues), 45.8 bits, see alignment E=7.3e-16 PF00561: Abhydrolase_1" amino acids 26 to 264 (239 residues), 94.3 bits, see alignment E=1.5e-30 PF12697: Abhydrolase_6" amino acids 27 to 272 (246 residues), 87.2 bits, see alignment E=3.9e-28

Best Hits

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 100% identity to syf:Synpcc7942_0774)

Predicted SEED Role

"Possible alpha/beta hydrolase superfamily, slr1916 homolog" in subsystem Synechocystis experimental

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q63 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Synpcc7942_0774 esterase (Synechococcus elongatus PCC 7942)
MPHLNLRGSLHAYDQTDQTDGDPELTLVFLHGWLLSRTYWQPLITRLRSQWPCLSYDLRG
FGESAANPDLGHSPADYAEDLIALLTALDLRRVWLVGHSLGGTVALWAARLCPDRVAGVI
GVNAGGGIYIEREFERFRGFGQQLIRWRPQWLRQIPGAELPFCWDSVHRPLPRKWARQRL
QDFLGADARAAIGILLDSTTAEQVHCLPSLVARLTQPVYFLAGDRDSIMPPAYVQHLASF
HPSFGLEGRNLRQLRHCGHLAMLEQTDAVAEAIQTWVSQSTRPQLNCDASVQPSI