Protein Info for Synpcc7942_0774 in Synechococcus elongatus PCC 7942

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 22 to 242 (221 residues), 45.8 bits, E=7.3e-16
• PF00561: Abhydrolase_1
  • amino acids 26 to 264 (239 residues), 94.3 bits, E=1.5e-30
• PF12697: Abhydrolase_6
  • amino acids 27 to 272 (246 residues), 87.2 bits, E=3.9e-28

Best Hits

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 100% identity to syf:Synpcc7942_0774)

Predicted SEED Role

"Possible alpha/beta hydrolase superfamily, slr1916 homolog" in subsystem Synechocystis experimental

MetaCyc Pathways

• superpathway of menaquinol-9 biosynthesis (10/10 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (8/9 steps found)
• superpathway of phylloquinol biosynthesis (12/15 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

See Q31Q63 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Synpcc7942_0774 esterase (Synechococcus elongatus PCC 7942)
MPHLNLRGSLHAYDQTDQTDGDPELTLVFLHGWLLSRTYWQPLITRLRSQWPCLSYDLRG
FGESAANPDLGHSPADYAEDLIALLTALDLRRVWLVGHSLGGTVALWAARLCPDRVAGVI
GVNAGGGIYIEREFERFRGFGQQLIRWRPQWLRQIPGAELPFCWDSVHRPLPRKWARQRL
QDFLGADARAAIGILLDSTTAEQVHCLPSLVARLTQPVYFLAGDRDSIMPPAYVQHLASF
HPSFGLEGRNLRQLRHCGHLAMLEQTDAVAEAIQTWVSQSTRPQLNCDASVQPSI