Protein Info for Synpcc7942_0701 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF13279: 4HBT_2" amino acids 21 to 130 (110 residues), 46.6 bits, see alignment E=4.7e-16 PF03061: 4HBT" amino acids 30 to 114 (85 residues), 48.1 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 52% identical to Y410_SYNY3: Putative esterase sll0410 (sll0410) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to syc:syc0829_c)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QD6 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Synpcc7942_0701 hypothetical protein (Synechococcus elongatus PCC 7942)
MSADINLENVAPPWFDYPLRVQPHHTDYAGIVWHGTYLAWLEEARVECLRSVGVAFSDLV
ALGVDLPVVDLGVRYRRAIALGESVLVRVRTGPSQGVRLVWDCQICLSPDQVCATAQVIL
APVDRQRGRILRQLPEPLEAAIARLQAGQYSPE