Protein Info for Synpcc7942_0701 in Synechococcus elongatus PCC 7942
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to Y410_SYNY3: Putative esterase sll0410 (sll0410) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to syc:syc0829_c)Predicted SEED Role
"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31QD6 at UniProt or InterPro
Protein Sequence (153 amino acids)
>Synpcc7942_0701 hypothetical protein (Synechococcus elongatus PCC 7942) MSADINLENVAPPWFDYPLRVQPHHTDYAGIVWHGTYLAWLEEARVECLRSVGVAFSDLV ALGVDLPVVDLGVRYRRAIALGESVLVRVRTGPSQGVRLVWDCQICLSPDQVCATAQVIL APVDRQRGRILRQLPEPLEAAIARLQAGQYSPE