Protein Info for Synpcc7942_0670 in Synechococcus elongatus PCC 7942

Name: pyrB
Annotation: aspartate carbamoyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00670: aspartate carbamoyltransferase
  • amino acids 7 to 329 (323 residues), 341.1 bits, E=2.7e-106
• PF02729: OTCace_N
  • amino acids 7 to 153 (147 residues), 147.3 bits, E=3.6e-47
• PF00185: OTCace
  • amino acids 169 to 327 (159 residues), 102.3 bits, E=2.9e-33

Best Hits

Swiss-Prot: 100% identical to PYRB_SYNP6: Aspartate carbamoyltransferase (pyrB) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to syc:syc0859_c)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

See Q31QG7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Synpcc7942_0670 aspartate carbamoyltransferase catalytic subunit (Synechococcus elongatus PCC 7942)
VSDWQRRHILSLADFSPVEYEMVLRTAAGFAEVLQRRNKKVPTLQGQVVTTLFFEPSTRT
RSSFELAAKRLSADTINFAASSSSLSKGETILDTARTYLAMGSDIMVVRHAQAGVPQAIA
REMERLGTEVRVLNAGDGQHEHPSQALLDLFTICSVIQPEQPSLGAIAGKKIAIVGDILH
SRVARSNIWSLTAAGAEVHLAAPPTLLPPEFAQFANTPIPGSGLPRQLQIHWQLESALEN
ADFVMTLRLQQERMSQSLLPSLREYHREFGLTRDRLRVCQPSVKLLHPGPVNRGVELSSD
LMEDESISLIQPQVTNGVAVRMALLYLIGAAVPAAIPA