Protein Info for Synpcc7942_0664 in Synechococcus elongatus PCC 7942

Annotation: Cyclic nucleotide-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details PF21088: MS_channel_1st" amino acids 69 to 110 (42 residues), 32.2 bits, see alignment 1.7e-11 PF00924: MS_channel_2nd" amino acids 113 to 177 (65 residues), 75.3 bits, see alignment E=6.6e-25 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 58 bits, see alignment E=2.1e-19 PF00027: cNMP_binding" amino acids 324 to 402 (79 residues), 70.6 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0664)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QH3 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Synpcc7942_0664 Cyclic nucleotide-binding (Synechococcus elongatus PCC 7942)
MDLFDRLEQWTSTPLLRLGSSQISLGSLILLAVLAGLLLYLMRQMNRWLREIVLVRLGVE
RGPREAIATITSYLLTSLILIIGLQAIGVDLSSLTVLAGVLGLGLSLGLQRLAASFFSGI
TLLIEQPIKVGDLVSLDGVLGTVEKISFRATAVRTLDHVHVIVPNDRLVDSNIINWSYQN
TASRVHLPISVAYGTDPLWLTDALLTVARQDSRVLTQPAPTVWFRSFGDSTLNFELLFWT
DRPELIEPIKSDLNFRIASEFERREIQIPFPQLVLHRHRSVTTSELPDDYLPSLLRRVDL
FRDYDDSQIRWLIEKGRRRTCVVGDVLCREGELGEEFYLILNGRFSVQVKGREEAIATLE
SGNFFGELAVMLDIPRTATVVALEPGTLFVVDRNNLRHLLERCPNLSQVMAEQLAQRQQV
LTNAGLLTPTANQSRPDQLRGILRRVLRL