Protein Info for Synpcc7942_0640 in Synechococcus elongatus PCC 7942

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 27 to 293 (267 residues), 168.6 bits, see alignment E=2.4e-53 PF00005: ABC_tran" amino acids 361 to 509 (149 residues), 102.4 bits, see alignment E=3.4e-33

Best Hits

Swiss-Prot: 34% identical to YKNU_BACSU: Uncharacterized ABC transporter ATP-binding protein YknU (yknU) from Bacillus subtilis (strain 168)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to syc:syc0885_c)

Predicted SEED Role

"ATP-binding protein of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QJ7 at UniProt or InterPro

Protein Sequence (588 amino acids)

>Synpcc7942_0640 ATPase (Synechococcus elongatus PCC 7942)
MSVSFSSRQRLAMLGQYIRPYWRPAVLGIVALLAVNGVGVVLPLLIRTCVDDVQDGLGFG
DVVRYSALILGLASVMWVIRMASRVLLFGVGRKVEFDLKQRLFEHLLRLEPTYFANMPLG
DLINRATSDVESIRRLVGFAVLSLVNTIFAYVLTLPLMLAIDPLLSLAALAVYPILLLLV
QLFSQRLRQEQQDVQEELSEISQLIQEDMSGISLIKIYAQESNERAAFGRLNQKLLKSNL
KLTKTRNVLFPLLEGLASFSLLILLWLGGQAIEGNRITVGDLIALILYVERLVFPTALLG
FTITAFQRGEVSVDRIEEILQHPPLIQDVPEALVVPPSELTGAIKVDGLTIHYPGQPQPA
LSNISFMVQPGETIAIVGPIGSGKSTLANALPRLLDVPTDSIFLDGLDITQLSLNSLRRA
IAYVPQDSFLFSLPIRDNIRYGNPEVSEAEIIAAAQQAQIDREILNFPRRYDTLVGERGI
TLSGGQRQRTALARALLLQAPVLILDDALASVDNQTATQILQALNGDRDRQRTVIFISHQ
LAAAATADRILVLDRGHLVQSGSHRELLATEGLYRSLWERQQLEELCA