Protein Info for Synpcc7942_0610 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 192 to 216 (25 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 415 to 479 (65 residues), 69.1 bits, see alignment E=2.9e-23 PF21082: MS_channel_3rd" amino acids 486 to 572 (87 residues), 44 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to syf:Synpcc7942_0610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8VPU8 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Synpcc7942_0610 hypothetical protein (Synechococcus elongatus PCC 7942)
MESVLRGRTVGLQGYPHRGRRRIRWAGLWVLGLLLAIAWPSAAQVAPALPTPASNPPAQV
KRFGNVEVAPVRLPLLQTPLLEVTAPTVYDRSDPAQQQASVEQRATQISANLRRALDRFQ
EAKTIQVVVSQLNGEPILLLSDGRSQPIRLVTVTSLDADYNGLSQAELAEQWRSQIQAEI
ERSRQILSPRNWLATLGAVARILCLAAIASLLFWWVQRELNYRAAQLEAQQRVPAAVPEP
STQEAEAEPLALLQQRSHLLNRLRPVSVLDAKLSWNRWFRWLLFWLLIALWYWASFQIIT
VTPVLDQFRDEWLNVPIRLIGLWFAGGVAIRIAHLLIERSAKAWERSALLAVEGDRRRSE
LRVTTIVRASKGLATALVAFAVLLAVLNTLGLPASSVLAGSAILGLAISFGSQSLVKDLV
NGCLILVEDQFAVGDVINVNGQGGLVETLNLRVTQIRDAEGGLITIPNSTISQVRNLSRT
WSRVDFNLEVGWENDVDQVLACLTHVVENLYADPEWQALICEPPEVLGVDAIAHQGVLIK
IWIKTQPLMQWKVGRELRRRVHHALQAEGISIGRPQQLVYWPELEGQPQPEGAIAAGRH