Protein Info for Synpcc7942_0608 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 98% identical to MTND_SYNP6: Acireductone dioxygenase (mtnD) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 100% identity to syf:Synpcc7942_0608)

MetaCyc: 55% identical to acireductone dioxygenase (Klebsiella oxytoca)
Acireductone dioxygenase (Fe(2+)-requiring). [EC: 1.13.11.54]; Acireductone dioxygenase (Ni(2+)-requiring). [EC: 1.13.11.54, 1.13.11.53]

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

L-methionine salvage cycle III (9/11 steps found)
3-methylthiopropanoate biosynthesis (1/1 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (5/7 steps found)
L-methionine salvage cycle I (bacteria and plants) (8/12 steps found)
L-methionine salvage cycle II (plants) (6/11 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.54

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>Synpcc7942_0608 hypothetical protein (Synechococcus elongatus PCC 7942)
MTVLTIYREDLPEQPLTQTTDAAEIAALLAQQGLRFERWPAQVELADDATPEQILAAYAT
EVDRVKTEGGYITVDAVSLRPDHPDRAALRQKFLAEHIHSEDEVRFFVAGQGLFSLHLGD
HVYALLCTQNDWISVPAGTRHWFDMGSQPYFTALRFFNNPEGWVAQFTGSDIASQFPLLP