Protein Info for Synpcc7942_0604 in Synechococcus elongatus PCC 7942

Name: rpe
Annotation: ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 28 to 224 (197 residues), 301.6 bits, E=1e-94
• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 28 to 237 (210 residues), 315.1 bits, E=8.6e-99

Best Hits

Swiss-Prot: 83% identical to RPE_SYNY3: Ribulose-phosphate 3-epimerase (rpe) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 100% identity to syf:Synpcc7942_0604)

MetaCyc: 53% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• ethene biosynthesis V (engineered) (24/25 steps found)
• oxygenic photosynthesis (17/17 steps found)
• Calvin-Benson-Bassham cycle (13/13 steps found)
• Bifidobacterium shunt (14/15 steps found)
• Rubisco shunt (10/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• heterolactic fermentation (13/18 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Sequence Analysis Tools

See Q31QN3 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Synpcc7942_0604 ribulose-phosphate 3-epimerase (Synechococcus elongatus PCC 7942)
MARAPAVGKLRSDRRFSPKAMTQKSVVIAPSILSADFSRLGDDVRAVDQAGADWIHVDVM
DGRFVPNITIGPLIVEALRPVTQKPLDVHLMIVEPEKYVPDFAKAGADIISVQAEACPHL
HRNLAQIKDLGKQAGVVLNPSTPVETLEYVLELCDLILIMSVNPGFGGQSFIPAVLPKIR
KLRAMCDERGLDPWIEVDGGLKANNTWQVLEAGANAIVAGSAVFNAPDYAEAIAAIRNSK
RPELVTA