Protein Info for Synpcc7942_0578 in Synechococcus elongatus PCC 7942

Name: sqdB
Annotation: UDP-sulfoquinovose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF01370: Epimerase" amino acids 3 to 293 (291 residues), 82.6 bits, see alignment E=4.7e-27 PF16363: GDP_Man_Dehyd" amino acids 4 to 325 (322 residues), 56.5 bits, see alignment E=5.1e-19

Best Hits

KEGG orthology group: K06118, UDP-sulfoquinovose synthase [EC: 3.13.1.1] (inferred from 100% identity to syf:Synpcc7942_0578)

MetaCyc: 100% identical to UDP-sulfoquinovose synthase (Synechococcus elongatus PCC 7942 = FACHB-805)
UDP-sulfoquinovose synthase. [EC: 3.13.1.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.13.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q54734 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Synpcc7942_0578 UDP-sulfoquinovose synthase (Synechococcus elongatus PCC 7942)
VKILVLGGDGFCGWPCALNLAAAGHAVTIVDNLVRRKTDVELGVQSLTPIATIERRLKAW
QETGGQPISFVNLDLAADYDRLCALLLETQPDAIVHFAEQRAAPYSMKSAWHKRFTVNNN
VNATHNLLCACVDVGLKSHIVHLGTMGVYGYGSHRGATIPEGYLEVEVVQRDGQRFEEKI
LHPVDPGSVYHMTKTLDQLLFYYYNKNDNIQVTDLHQGIVWGTNTDHCNLHPDLTNRFDY
DGDYGTVLNRFLMQAAIGYPLTVHGVGGQTRAFIHIRDSVRCVQLAIENPPAANEKVRIF
NQMTETYQVKDLAEKVAALTGAEIAYLPNPRKEALENDLIVDNRCLIDLGLNPTTLDNGL
MSEVVEIAQKFADRCDRAKIPCVSAWTRNQAEALSAPETALR