Protein Info for Synpcc7942_0563 in Synechococcus elongatus PCC 7942

Name: uvrB
Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 TIGR00631: excinuclease ABC subunit B" amino acids 4 to 659 (656 residues), 1082.6 bits, see alignment E=0 PF04851: ResIII" amino acids 14 to 137 (124 residues), 40.5 bits, see alignment E=8.2e-14 PF17757: UvrB_inter" amino acids 158 to 247 (90 residues), 112.8 bits, see alignment E=2e-36 PF00271: Helicase_C" amino acids 433 to 543 (111 residues), 75.8 bits, see alignment E=9.6e-25 PF12344: UvrB" amino acids 550 to 590 (41 residues), 74.4 bits, see alignment 1.5e-24 PF02151: UVR" amino acids 627 to 660 (34 residues), 45.9 bits, see alignment (E = 9.5e-16)

Best Hits

Swiss-Prot: 100% identical to UVRB_SYNE7: UvrABC system protein B (uvrB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to syc:syc0959_d)

MetaCyc: 61% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QS4 at UniProt or InterPro

Protein Sequence (666 amino acids)

>Synpcc7942_0563 excinuclease ABC subunit B (Synechococcus elongatus PCC 7942)
MTPFQLQARYQPMGDQPTAIAQLVEQVQAGAPYQTLLGATGTGKTFTIANVIAQVGRPAL
VLAHNKTLAAQLCNELREFFPNNAVEYFISYYDYYQPEAYIPVTDTYIAKTASINEEIDM
LRHSATRNLFERRDVIVVASISCIYGLGIPSEYLKAAIPLEVGAEINMREVLRQLVDVQY
SRNDLESGRGRFRVKGDVLEIGPAYEDRIIRVEFFGDEIDAIRYIDPVTGEILQSLDRLN
IYPARHFVTPEERLEIAIAEIKEELNQQLLTLQAEGKLVEAQRLEQRTRYDLEMLQEVGY
CNGVENYARHLAGREPGSPPECLIDYFPKDWLLVVDESHVTVPQLRGMYNGDQSRKKVLV
DHGFRLPSAADNRPLKSEEFWEKVRQCIFVSATPGDWEIERSEEQIVEQVIRPTGVVDPE
VFVRPTEGQVDDLLAEIQQRVRRQERALITTLTKRMAEDLTDYLSDRGVKVRYLHSEINS
IERIEILQDLRNGDFDVLIGVNLLREGLDLPEVSLVAILDADKEGFLRTERSLIQTIGRA
ARHINGQAILYADRMTESMEKAISETERRRRIQLDYNQRHNITPQPIIKRSSNAILSFLE
VSRRLNKQELEVAVSQADDLSLEEIPNLITQLEAQMKEAAKNLEFEEAAQYRDRIKKLRE
RLVGRH