Protein Info for Synpcc7942_0516 in Synechococcus elongatus PCC 7942

Name: ctpB
Annotation: C-terminal processing peptidase-2. Serine peptidase. MEROPS family S41A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 70 to 389 (320 residues), 353.6 bits, see alignment E=5.1e-110 PF00595: PDZ" amino acids 118 to 189 (72 residues), 35.7 bits, see alignment E=1.9e-12 PF13180: PDZ_2" amino acids 121 to 199 (79 residues), 31 bits, see alignment E=5.1e-11 PF17820: PDZ_6" amino acids 137 to 191 (55 residues), 38.3 bits, see alignment 1.9e-13 PF03572: Peptidase_S41" amino acids 222 to 382 (161 residues), 189.7 bits, see alignment E=5.8e-60

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to syf:Synpcc7942_0516)

Predicted SEED Role

"carboxyl-terminal protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QX1 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Synpcc7942_0516 C-terminal processing peptidase-2. Serine peptidase. MEROPS family S41A (Synechococcus elongatus PCC 7942)
MSLFSRLRFSVYGSALLAASGAVCIGISAEHARALPWQDSPKVVLDQAWQLIDREYVDPT
FNRQDWQAVRRELLSRNYGSNEEAYAALRSALRRLDDPYTRFLAPEQFKTLTEQTAGEAS
GIGIEIIPDSKDSRPRIQAILDNSPASKGDVQVGDRILAIDADSTRELTLDEVRNRLQGK
VGSEIDLKLQRGDRIFSVKLTRVQIEIPSVTAELRQHSGRSVGYIQLREFTAHAAREMRT
SIRSLDEQGATSYVLDLRGNPGGLLYSSIEIARMWLNNGTIVKTVDRNGKSETINANNSA
ITNKPLAVLVDQNSASSSEILVGALKDNNRAVVIGRQTFGKALVQSVHTLADGSGLAVTV
AHYYTPNGTDLGNRGIQPDVEVRLNQRQQALQRSDPSFLGSNQDPTYGQAIATLEQRTAE
STPSPASSPQLSQRPSEIRP