Protein Info for Synpcc7942_0502 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF13302: Acetyltransf_3" amino acids 12 to 153 (142 residues), 117.4 bits, see alignment E=8.4e-38 PF00583: Acetyltransf_1" amino acids 36 to 151 (116 residues), 37.8 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 52% identical to ATSE3_PSEAE: Acetyltransferase PA3944 (PA3944) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to syc:syc1018_d)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QY5 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Synpcc7942_0502 hypothetical protein (Synechococcus elongatus PCC 7942)
MQSAIAELNTDRLRLRAWQESDREPFAVLNADPGVMEHFPACLSRAESDDLVDRIEAHWQ
QWGFGLWAVEQKSDRAFIGFIGLKTVPFEADFTPAVEIAWRLAQPYWGQGFASEGAKATL
QFGFEQLQLDTIVSFTAVCNQRSQRLMQRLGLQQVGTFEHPALPEGDRLRTHVLYRGDRQ
QWQAGLLG