Protein Info for Synpcc7942_0477 in Synechococcus elongatus PCC 7942

Name: ylmG
Annotation: conserved hypothetical protein YCF19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 65 to 80 (16 residues), see Phobius details PF02325: YGGT" amino acids 15 to 82 (68 residues), 79.1 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 45% identical to YCF19_GUITH: Uncharacterized protein ycf19 (ycf19) from Guillardia theta

KEGG orthology group: K02221, YggT family protein (inferred from 100% identity to syf:Synpcc7942_0477)

Predicted SEED Role

"Cell division protein YlmG/Ycf19 (putative), YggT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31R10 at UniProt or InterPro

Protein Sequence (99 amino acids)

>Synpcc7942_0477 conserved hypothetical protein YCF19 (Synechococcus elongatus PCC 7942)
MMSSSLGLLLNTLSITLNIYFVLLIIRVLLSWFPNFQSSQFMLILGQLTDPYLNLFRRVI
PPLGGMDFSPILAFFILQAVTQAVQQLAVQTSGSFSAFY