Protein Info for Synpcc7942_0434 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 9 (9 residues), see Phobius details transmembrane" amino acids 10 to 33 (24 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details PF03773: ArsP_1" amino acids 5 to 332 (328 residues), 261.5 bits, see alignment E=4.6e-82

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to syc:syc1083_c)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8GMQ6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Synpcc7942_0434 hypothetical protein (Synechococcus elongatus PCC 7942)
MTRFYNAFTLFLSLLVEALPFLLLGVFLSSLLLCFTNEKALLRILPKNPLGGALAGSLVG
FLFPACECGNVPVTRRLILQGAPPAVAMGFLLAAPVINPIVIWSTWVAFRDQPEIVVLRV
LFTMIIATLVGWVFSAQKDLRPILQRRTADLLELTCPRPTNDQPALLQRGTFFLGQGSQP
AASIALESAIVSELAVPAGLWPKLSLALDNTLQELRDLGGVLILGSAVAALIQTFAPREL
ILSLGQGPVTSVIAMLVLGTVVSICSTVDAFFALAFASVFTSGALLAFLVLGPMVDLKGI
GMLLTVFRPRAVIYLFGLTTVMTFLLCLAVNFYLN