Protein Info for Synpcc7942_0417 in Synechococcus elongatus PCC 7942

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF00004: AAA" amino acids 262 to 393 (132 residues), 95.3 bits, see alignment E=4.3e-31 PF17862: AAA_lid_3" amino acids 418 to 453 (36 residues), 29.3 bits, see alignment 5.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0417)

Predicted SEED Role

"FIG00876461: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31R70 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Synpcc7942_0417 ATPase (Synechococcus elongatus PCC 7942)
MREELGILLQAQYPLIYLITSEEERSERSLATLAQTCGSRQLFLWTVTHGVIEYGQPRQV
AHHSTVSPEAAIEWVVRHKGPGIYVFKDLHPFIESPAVTRWLRDAIAQFKSAEKTIILMS
PVQTVPVELEKDVVVLDFPLPDLAELGSVLDRELDRRSLPRPSESGREKLLKATLGLTRD
EAEKVYRKAQVTTGRLTEAEVDVILSEKQQLIRRNGILEFIEEDETLDAVGGLEELKHWL
RQRSGAFSEKARSYGLPQPKGMLILGVPGCGKSLIAKTTSRLWGLPLLRLDIGRVYDGST
VGRSEANLRNALKTAESIAPAILFIDELDKAFAGSAGSADSDGGTSSRIFGSFLTWMQEK
RSPVFVMATANRVERLPGEFLRKGRFDEIFFVDLPTPEERAEIFRIHLAKRKRPLDRFDL
EQLAKVSDGFSGAEIEQALIAAMYEAFAQEREFTQLDIIAAIKSTLPLSKTMNEQVAALR
DWARQRARPAAASVAEYQRLEF