Protein Info for Synpcc7942_0368 in Synechococcus elongatus PCC 7942

Name: xseA
Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF13742: tRNA_anti_2" amino acids 49 to 142 (94 residues), 60.5 bits, see alignment E=2.3e-20 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 49 to 436 (388 residues), 399.5 bits, see alignment E=8.9e-124 PF01336: tRNA_anti-codon" amino acids 71 to 140 (70 residues), 28.3 bits, see alignment E=2.1e-10 PF02601: Exonuc_VII_L" amino acids 167 to 388 (222 residues), 243.1 bits, see alignment E=8.2e-76 amino acids 350 to 433 (84 residues), 57.3 bits, see alignment E=3e-19

Best Hits

Swiss-Prot: 52% identical to EX7L_NOSS1: Exodeoxyribonuclease 7 large subunit (xseA) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to syf:Synpcc7942_0368)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RB9 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Synpcc7942_0368 exodeoxyribonuclease VII large subunit (Synechococcus elongatus PCC 7942)
MEAIVSFSSCNFWCLPCLISCVESDWQGGAVCEEKGWVTMGDRGLSAISVAGVSDYLESL
IGEDVRLRQLWIFGEVSSCKPHAVGLFFSLKDSQTTDLLDCVVWKNGLAQLQHRPEIGQQ
VLLLGTVRLYRKRSGYQLQVVQCLPFGDGLKALQRQKLEQRLQAEGLFDRDRKRPLPLYP
QTIAVVTSPQAAAWGDIQRSLRQRSPGLKVLLSPTLVQGDQAPAAIATAIARVVADGRAE
LLILARGGGAREDLECFDDEQVVRAIATCPIPVVTGLGHEQDETLADRVADWAAHTPTAA
AIRSVPAWTELRQAWQQLRQRLIHAQRQQWQDYRRQLQHCQTRLGWPLLQRRLQQAQHQQ
QSLRQRLQQASRLQLAQERQHLDHLQELLAILNPESVLQRGYALVRRDRTLIQQVQDLQV
GDRLSLQWADGTAGVCVETVTAAVENQSDR