Protein Info for Synpcc7942_0367 in Synechococcus elongatus PCC 7942

Annotation: Na+-dependent transporter-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 195 to 222 (28 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details PF01758: SBF" amino acids 12 to 197 (186 residues), 147.7 bits, see alignment E=3.4e-47 PF13593: SBF_like" amino acids 13 to 280 (268 residues), 69.9 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to syf:Synpcc7942_0367)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RC0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Synpcc7942_0367 Na+-dependent transporter-like (Synechococcus elongatus PCC 7942)
MQSSFLSAVLLPLALVIIMFGMGLTLTVQDFRRVWIAPKAVAIGLIAQLVMLPLLGFAIA
SLTPLSPELAVGVIILAACPGGPTSNLFTFLAAGDVALSITLTAISSLITVFSIPWVVNL
GLQAFLDQTSTFQLPFGPTVVQIAVVAIIPVVLGMLVRHYAPQLAQRTDRSLRWISTAFL
AAVIVGFFAQERQNILAFFQSVGGVVLLLNLLAMALGVGLASLTRLGYARATTIGLEVGI
QNGTLAIAIAASPTLLNNPAMAIPAAIYSLVMFMTGGIFVWLRQRYQPTRAVQTAAEVPA
AVGSHLE