Protein Info for Synpcc7942_0366 in Synechococcus elongatus PCC 7942

Name: ltnT
Annotation: putative sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 400 to 429 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 19 to 381 (363 residues), 59.1 bits, see alignment E=5.3e-20 PF01740: STAS" amino acids 470 to 545 (76 residues), 31.9 bits, see alignment E=1.4e-11 PF00027: cNMP_binding" amino acids 614 to 692 (79 residues), 44.5 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc1147_c)

Predicted SEED Role

"Sulfate transporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RC1 at UniProt or InterPro

Protein Sequence (727 amino acids)

>Synpcc7942_0366 putative sulfate transporter (Synechococcus elongatus PCC 7942)
MAWVGQRLIADLKSAPLRNILAGLVSGLLLLGENISAGLLIYSNVLSPYLASGLAALLIS
TACLNFFAVNRRGLPYGLATPDSRIYSLLAVIAAAISQSEALADTRMLGVTLLIYWVVAT
ACIGVALWLMGRCGIGEWLRYIPYPVVGGFLAATGWLLLTGGLNVALGFKISGATLERLW
SVDSAAKILVAVVFGLLLWQLGTRSKRVWITPVLLLAGLVGAQLVRVGLGYSLAEAAQFG
WFLPPLAPRIVFFWDWPRIPSIDWALLLPQIALIPVLILLAAISLTLNLSSLENVEKREL
DLNQELQRTGLANLIMLPFGGFSPGLLSGSRSTLNRLAGASTPLAAGVAAVLMLIAIALG
DLASWLCKPILAGLLVNIGLVYIDRWVFRSIRLLPQREYWVTIAILGISIVGGFLEAITA
GIVFSSLTFVVSYCRAPAIRSMATGAYLHSNIERVETQQSILRRRGAVLQVVSLQGYLFF
GTARRIVSTVRDRLQQSKVSINLVLLDYQAVTGADSSTAEVFSRFAVELQAQSIQLWVAA
IASDYQKPLRPFLQLLPEHQQFPDLNTALQAAEAKLLDQYARRPKSLPFALLLPELLALP
DDCDVPLQFWQRSQLKDGEVLYQQGDRADTIYWLERGELHLQATEAWDARQVLAGSPCGE
LAFLRGDTQPQTAIAVGRCMVYGLNRAALTELEASYPTVAIALYRWLLHRQSEQLQDQQL
RQHYLQA