Protein Info for Synpcc7942_0348 in Synechococcus elongatus PCC 7942

Name: recA
Annotation: recombinase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02012: protein RecA" amino acids 11 to 330 (320 residues), 548.1 bits, see alignment E=3.6e-169 PF00154: RecA" amino acids 14 to 274 (261 residues), 449 bits, see alignment E=1.1e-138 PF08423: Rad51" amino acids 40 to 233 (194 residues), 33.1 bits, see alignment E=7.1e-12 PF21096: RecA_C" amino acids 277 to 332 (56 residues), 79.5 bits, see alignment E=3.3e-26

Best Hits

Swiss-Prot: 100% identical to RECA_SYNE7: Protein RecA (recA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to syc:syc1165_d)

MetaCyc: 62% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RD9 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Synpcc7942_0348 recombinase A (Synechococcus elongatus PCC 7942)
MASKSDAIAPEKEKALNLVLSQIERNFGKGAIMRLGDAARLRVETISTGALTLDLALGGG
LPKGRIIEVYGPESSGKTTLTLHAIAEVQKQGGIAAFVDAEHALDPVYATSVGVDIDNLL
ISQPDTGEMALEIVDQLVRSAAVDIVVIDSVAALVPRAEIEGEMGDAQVGLQARLMSQAM
RKITGNIGKSGCTVIFLNQLRQKIGVTYGSPETTTGGQALKFYASVRLDIRRIQTLKKGT
EEYGTRAKVKVVKNKVAPPFRIAEFDILFGKGISTLGCLVDLAEETGVILRKGAWYSYNG
DNIGQGRDNTITHLEEHPDFRATVEQQVREKLALGAQVSANTVGAAPAKTAEDTDS