Protein Info for Synpcc7942_0331 in Synechococcus elongatus PCC 7942

Name: atpI
Annotation: F0F1 ATP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 47 to 251 (205 residues), 144.9 bits, see alignment E=1.8e-46 PF00119: ATP-synt_A" amino acids 49 to 248 (200 residues), 180.3 bits, see alignment E=2.5e-57

Best Hits

Swiss-Prot: 100% identical to ATP6_SYNP6: ATP synthase subunit a (atpB) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to syc:syc1182_c)

MetaCyc: 100% identical to ATP synthase Fo, a subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP synthase F0 sector subunit a (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RF6 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Synpcc7942_0331 F0F1 ATP synthase subunit A (Synechococcus elongatus PCC 7942)
MGSATLPSDLMSMPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVV
LSLLANRNLQRIPSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWS
GALIPWKLIKLPSGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVM
LPFKILEDFTKPLSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIF
ATLAASYIGEAVEEHGEEHAE