Protein Info for Synpcc7942_0282 in Synechococcus elongatus PCC 7942

Name: glyA
Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 10 to 386 (377 residues), 582.9 bits, E=2.7e-179
• PF00155: Aminotran_1_2
  • amino acids 82 to 376 (295 residues), 31 bits, E=1.6e-11

Best Hits

Swiss-Prot: 100% identical to GLYA_SYNP6: Serine hydroxymethyltransferase (glyA) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to syc:syc1231_d)

MetaCyc: 78% identical to glycine hydroxymethyltransferase (Synechocystis sp. PCC 6803)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• photorespiration I (8/9 steps found)
• photorespiration III (8/9 steps found)
• photorespiration II (8/10 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• glycine degradation (2/3 steps found)
• folate transformations II (plants) (7/11 steps found)
• folate transformations I (8/13 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• glycine betaine degradation III (3/7 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• glycine betaine degradation I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

See Q31RK5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Synpcc7942_0282 serine hydroxymethyltransferase (Synechococcus elongatus PCC 7942)
VTETNFDFLAQGDPAIAAIIGRELQRQQEHLELIASENFASPAVMAAQGSVLTNKYAEGL
PSKRYYGGCEFVDQAEELAIERAKELFGAAHANVQPHSGAQANFAVFLTLLQPGDTFLGM
DLSHGGHLTHGSPVNVSGKWFNAGHYGVNRETERLDYDAIRELALQHRPKLIICGYSAYP
RTIDFAKFREIADEVGAYLLADMAHIAGLVAAGLHPSPIPHCDVVTTTTHKTLRGPRGGL
ILTRDAELGKKLDKSVFPGTQGGPLEHVIAAKAVAFGEALRPEFKTYSAQVIANAQALAR
QLQARGLKIVSDGTDNHLLLVDLRSIGMTGKVADLLVSDVNITANKNTVPFDPESPFVTS
GIRLGTAAMTTRGFKEAEFAIVADIIADRLLNPEDSSMEDSCRRRVLELCQRFPLYPHLS
PATPVAV