Protein Info for Synpcc7942_0280 in Synechococcus elongatus PCC 7942

Name: cinA
Annotation: competence damage-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 8 to 417 (410 residues), 510.3 bits, see alignment E=3.3e-157 PF00994: MoCF_biosynth" amino acids 9 to 175 (167 residues), 125.8 bits, see alignment E=1.7e-40 PF18146: CinA_KH" amino acids 186 to 258 (73 residues), 81 bits, see alignment E=8.1e-27 PF02464: CinA" amino acids 262 to 416 (155 residues), 177.7 bits, see alignment E=1.9e-56 TIGR00199: amidohydrolase, PncC family" amino acids 268 to 417 (150 residues), 162.8 bits, see alignment E=6e-52

Best Hits

Swiss-Prot: 100% identical to CINAL_SYNE7: CinA-like protein (Synpcc7942_0280) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 100% identity to syf:Synpcc7942_0280)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RK7 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Synpcc7942_0280 competence damage-inducible protein A (Synechococcus elongatus PCC 7942)
MSDPRYCAEIISVGTELLLGNILNSNAQFLAEELAQLGIPHYFQTVVGDNRDRLQSAVKI
AAERSGLLIFTGGLGPTPDDLTTETLAACFETPLAERPEVITDIEAKFARRGRVLTDNNR
KQALLPVGAELLPNPSGTAPGMIWSPRSGLTLMTFPGVPAEMRRMWTETAVPWLHQNDWC
RSILVSRLLRFWGISESALAEKVAPFFDLQNPTVAPYANNGEVKLRITAAAASEAEGVAL
IAPIEQELRAIAGRDCYGADNDSLASVVGALLHDRGQTLAVAESCTGGGLGQLITTIPGS
SQWFWGGAIAYDNRVKQSLLNVSAETLAEAGAVSAVVAEQMAIGIQQRLGTTWGVSITGI
AGPDGGTETKPVGLVYIGIAGPTGCFSVERRWGAERGRDWVRRLSAGEALDQLRRSLLNL
T