Protein Info for Synpcc7942_0137 in Synechococcus elongatus PCC 7942

Name: hemH
Annotation: ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 363 to 375 (13 residues), see Phobius details TIGR00109: ferrochelatase" amino acids 2 to 322 (321 residues), 415.9 bits, see alignment E=6.3e-129 PF00762: Ferrochelatase" amino acids 4 to 321 (318 residues), 409.9 bits, see alignment E=6.7e-127

Best Hits

Swiss-Prot: 100% identical to HEMH_SYNP6: Ferrochelatase (hemH) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 100% identity to syf:Synpcc7942_0137)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31S00 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Synpcc7942_0137 ferrochelatase (Synechococcus elongatus PCC 7942)
MGRVGVLLLNLGGPERLEDVGPFLYNLFADPEIIRLPFPWLQKPLAWLISSLRTRKSQEN
YKQIGGGSPLRRITEEQATALRQSLSDRGQAAQVYIGMRYWHPFTEEAIAQIKADGIDRL
VILPLYPQFSISTSGSSFRLLQRLRDRDPEFQKIDCSVVPSWYERSGYLQAMAELIAQEL
DKLEQPEQGHVFFSAHGVPVSYVEEAGDPYQREIEDCTRKIMETLGRSNPWTLAYQSRVG
PVEWLQPYTEDALEELAERGVKDLVVVPISFVSEHIETLEEIDIEYREIAEEAGIERFLR
VPALNTHPLFIQDLSDLVEQTLEQPRFRLEDVTLLPKKVKLYPQERWEWGITLNAEVWNG
RIAMLGFLALLVELLTGRGPLHALGLL