Protein Info for Synpcc7942_0107 in Synechococcus elongatus PCC 7942

Annotation: Small GTP-binding protein domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 264 to 286 (23 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 329 to 345 (17 residues), see Phobius details amino acids 356 to 379 (24 residues), see Phobius details amino acids 392 to 419 (28 residues), see Phobius details PF01926: MMR_HSR1" amino acids 71 to 196 (126 residues), 64.6 bits, see alignment E=2.3e-21 TIGR00231: small GTP-binding protein domain" amino acids 71 to 214 (144 residues), 51.4 bits, see alignment E=5.2e-18 PF00350: Dynamin_N" amino acids 128 to 186 (59 residues), 27.7 bits, see alignment E=6.7e-10 PF05128: DUF697" amino acids 283 to 450 (168 residues), 115.5 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: K06883, (no description) (inferred from 100% identity to syf:Synpcc7942_0107)

Predicted SEED Role

"Small GTP-binding protein domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31S30 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Synpcc7942_0107 Small GTP-binding protein domain (Synechococcus elongatus PCC 7942)
VVDSLQQWQEVEAVLADLSQASQEHHYRQTHRLVQDYLDRLQLSPREQQGLEPLLKSLER
MQAKLEQQVLHIAVFGLVGRGKSSLLNALVGETVFETGAIHGVTTAIATAAWPLTTDEDG
VQRLRWSGLGDVQVELIDTPGIDEIDGDQREALAKRVAQQADLILFVVSGDISQLEQDTL
TVLHQAHKPLLLVLNKADQYSDRDREAIRNKLADERLRHLISIDEIVTVAAAPRQAEPEY
DGDRLVGTKLVSLPPQVEPLRQRIITLLLHEGQSLLALNALLQMAMVDRQVVRRKLQSRD
RQAEELIWRFAIAKGMAVAINPISFVDLLGGAAIDVALILQLSQLYDLPIGEGKAIALLR
TIAVGMGSLGLGEGLVRVGLSALKGLMGVAAPVSGGLSLGVYVPVALTQAGIGGFATYAI
GQVTKAYLANGADWGPEGAGLLTQQILDSLDEAAILQRLRGEIDRRLRLKQL