Protein Info for Synpcc7942_0067 in Synechococcus elongatus PCC 7942

Annotation: probable permease protein of ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 14 to 203 (190 residues), 30.7 bits, see alignment E=3.5e-11 PF12679: ABC2_membrane_2" amino acids 47 to 203 (157 residues), 44.8 bits, see alignment E=1.5e-15 PF12730: ABC2_membrane_4" amino acids 72 to 201 (130 residues), 31.1 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to syf:Synpcc7942_0067)

Predicted SEED Role

"ABC-2 type transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31S70 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Synpcc7942_0067 probable permease protein of ABC transporter (Synechococcus elongatus PCC 7942)
MQRLHLLRDRAGVVLYERELRSYFGSPFFYGIAGAFWLLAGFFFNVQLQSLLSQLAAFDQ
QGGATITQPIDAPYLLIQNFMGVLGFLLLLLLPMLSMGLYTEERKRTTLELLLTAPVRNW
TVAIAKLLAVLTAVVGLLLPIALYEAIALGSSSPALSPWIFLSGYVGLLLLAAAVLSLGM
FLSSLTDSTVLAAILSFLLVLALWALDSLGGSVSGAIGDISRHLSLLQQYSQWVEGQVSS
ASVILFASAIGLGLFLTAQSVELLRVRRG