Protein Info for Synpcc7942_0065 in Synechococcus elongatus PCC 7942

Name: infC
Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00168: translation initiation factor IF-3
  • amino acids 19 to 181 (163 residues), 235.5 bits, E=1.2e-74
• PF05198: IF3_N
  • amino acids 19 to 88 (70 residues), 113 bits, E=6e-37
• PF00707: IF3_C
  • amino acids 95 to 180 (86 residues), 123.2 bits, E=3.5e-40

Best Hits

Swiss-Prot: 82% identical to IF3_MICAN: Translation initiation factor IF-3 (infC) from Microcystis aeruginosa (strain NIES-843)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to syc:syc1438_d)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See Q31S72 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Synpcc7942_0065 translation initiation factor IF-3 (Synechococcus elongatus PCC 7942)
MALPPQPNSARNLRNLPQINERIRFPKIRVVDTDGAQLGILTPAEALRIAEEKELDLVLV
SDKADPPVCRIMDYGKYKFEQEKRAREARKKQHNVEVKEVKMRYKIDEHDYQVRVNQAQR
FLKAGDKVKATITFRGREIQHTDLAQQLLMRLASDLKELGEVQQAPKKEGRNMMMMLGPK
KAGS