Protein Info for Synpcc7942_0061 in Synechococcus elongatus PCC 7942

Name: rfbG
Annotation: CDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 5 to 366 (362 residues), 523.1 bits, see alignment E=1.7e-161 PF04321: RmlD_sub_bind" amino acids 11 to 176 (166 residues), 32.1 bits, see alignment E=1.4e-11 PF01370: Epimerase" amino acids 11 to 254 (244 residues), 99.9 bits, see alignment E=3.1e-32 PF02719: Polysacc_synt_2" amino acids 11 to 204 (194 residues), 40.2 bits, see alignment E=4.7e-14 PF16363: GDP_Man_Dehyd" amino acids 12 to 340 (329 residues), 127.9 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 100% identity to syf:Synpcc7942_0061)

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31S76 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Synpcc7942_0061 CDP-glucose 4,6-dehydratase (Synechococcus elongatus PCC 7942)
MNSSFWRDRQVLITGHTGFKGSWLTLWLLMQGADVWGYALPPESERSLFTALDLANQRQA
GWGYFQYRLGEMNDAEALRQWVEQAQPEVVFHLAAQPLVRRSYADPLGTWQTNVLGSLQL
LEALKSLQHPCAMVMVTTDKVYENREWVYGYRETDCLGGHDPYSASKAAMELAVASWRSS
FCGDAAHQTPYLAIATARAGNVIGGGDWAVDRIVPDAVRSLSAGAAIAVRNSHSTRPWQH
VLEPLGGYLLLAQRLLEHQQSAEKTVNPFARAFNFGPAIESNRSVKELITTVLQHWPGQW
VDQSDPTAPHEAGLLHLVSDQARQLLGWQPRWDFETTVSRTIHWYRPVMMTGGSALEACL
EDLATYGQ